SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000037549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000037549
Domain Number 1 Region: 1-145,308-328
Classification Level Classification E-value
Superfamily L domain-like 1.5e-25
Family Ngr ectodomain-like 0.047
Further Details:      
 
Domain Number 2 Region: 513-570
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000428
Family Calponin-homology domain, CH-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000037549
Sequence length 574
Comment (Macaca mulatta)
Sequence
SRNQLSTLPVHLCNLPLKVLIASNNKLVSLPEEIGHLRHLMELDVSCNEIQTIPSQIGNL
EALRDLNVRRNHLVHLPEELAELPLIRLDFSCNKITTIPVCYRNLRHLQMITLDNNPLQS
PPAQICIKGKVHIFKYLNIQACKIAPDLPDYDRRPLGFGSCHEELYSSRPYGALDSGFNS
VDSGDKRWSGNEPTDEFSDLPLRVAEMTKEQRLRRESQYQENRGSLVVTNGGVEHDLDQI
DFIDSCAAEEEEAEVRQPKGPDSDSLSSQFMAYIEQRRISHEGSPVKPVAIREFQKTEDM
RRYLHQNRVPVEPSSLLSLSASHNQLSHTDLELHRRREQLVERTRREAQLAALQYEEEKI
RTKQIQRDAVLDFVKQKASQSPQKQQPLLDGECPFPSRRSQHTDDSALLVSLSGLNQVGC
AAPLPHSSAFTPLKSDDRPNTLLSSPTTETVHHSSAYAFPAAIQRNQPQRPESFLFRAGG
RAEANKGHASPLPPSAAPTTDSADSITRQNSRQREEELELIDQLRKHIEYRLKVALPCDL
GAALTDGVVLCHLANHVRPRSVPSIHVPSPAVVS
Download sequence
Identical sequences G8F177
ENSMMUP00000000259 ENSMMUP00000037549 9544.ENSMMUP00000037549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]