SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000041379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000041379
Domain Number 1 Region: 68-132
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000000536
Family F1F0 ATP synthase subunit C 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000041379
Sequence length 133
Comment (Macaca mulatta)
Sequence
MQTAGALLISQALICCSTRSLLRSVSASFLNRPNNPSYSSSPLHVARYGFQTSVVSWDID
TAAKFIDAGAITVGWIVTGSRAGRGMVFGSLIIRYAMSPSLKEQLFYAILGFALSEAMGL
FCLTVTFLIPFAM
Download sequence
Identical sequences ENSMMUP00000041379 9544.ENSMMUP00000041379 ENSMMUP00000041379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]