SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000005693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000005693
Domain Number 1 Region: 94-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-56
Family Matrix metalloproteases, catalytic domain 0.0000182
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000005693
Domain Number - Region: 19-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000275
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000005693
Sequence length 261
Comment (Pan troglodytes)
Sequence
MQLVILRVTIFLPWCFAIPVPPDADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSTV
KDSIYNAVSIWSNVTPLIFQQVQNEDADIKISFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNRSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDMP
Download sequence
Identical sequences ENSPTRP00000005693 9598.ENSPTRP00000005693 ENSPTRP00000005693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]