SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000010906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000010906
Domain Number 1 Region: 22-144,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-75
Family Calponin-homology domain, CH-domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 6192-6347
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 5972-6098
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 5885-6017
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000101
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 4896-5052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000012
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 6101-6210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000013
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 6639-6785
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000588
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 5064-5168
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 9 Region: 5761-5914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000985
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 5245-5378
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000564
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 6544-6666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000027
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 12 Region: 5596-5705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000157
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 13 Region: 3733-3880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000629
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 14 Region: 2697-2830
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000734
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 15 Region: 2099-2216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000018
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 16 Region: 1891-2032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 17 Region: 2225-2352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000059
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 18 Region: 3212-3317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000152
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 5179-5273
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000468
Family Spectrin repeat 0.0094
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000010906
Domain Number - Region: 2799-2937
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000117
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 1487-1602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000183
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 4588-4726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000374
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 339-430,616-666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0015
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3323-3465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0241
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1781-1897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0424
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number - Region: 2522-2618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0612
Family Spectrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000010906
Sequence length 6907
Comment (Pan troglodytes)
Sequence
MASSPELPTEDEQGSWGIDDLHISLQAEQEDTQKKAFTCWINSQLARHTSPSVISDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLRNRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEKLAQTLSCNYNQPSLDDVSVVDSSPASSPPAKKCSKVQARWQ
MSARKALLLWAQEQCATYESVNVTDFKSSWRNGMAFLAIIHALRPGLIDMKSVKHRSNKD
NLREAFRIAEQELKIPRLLEPEDVDVVDPDEKSIMTYVAQFLQYSKDAPGTGEEAQGKVK
DAMGWLTLQKEKLQKLLKDSDNDTYFKKYNSLLSFMESFNEEKKSFLDVLSIKRDPDELD
KDHLQLREAWDGLNHQINAWKIKLNYALPPPLHQTEAWLQEVEELMDEDLSASQDHSQAV
TLIQEKMTLFKSLMDRLEHHSNILLTFENKDENHLPLVPPNKLEEMKRRINNILEKKFIL
LLEFHYYKCLVLGLVDEVKSKLDIWNIKYGSRESVELLLEDWHKFIEEKEFLARLDTSFQ
KCGEIYKNLAGECQNISKQYMMVKSDVSMYRKKIYNVKSTLQKVLACWATYVENLRLLRA
CFEETKKEEIKEVPFETLAQWNLEHATLNEAGNFLVEVSNDVVGSSISKELRRLNKRWRK
LVSKTQLEMNLPLMIKKQDQPTFDNSGNILSKEEKATVEFSTDMSIELPENYNQNIKAGE
KHEKENEEFTGQLKVAKDVEKLIGQVEIWEAEAKSVLDQDDVDTSMEESLKHLIAKGSMY
DELMARSEDMLQMDIQNISSQESFQHVITTGLQTKIQEAKEKVQINVVKLIAALKNLTDV
SPELDIRLKMEESQKELESYMMRAQQLLGQRESPGELISKYKEALIISNTKSLAKYLKAV
EELKNNVTEDIKMSLEEKSRDVCAKWESLHHELSLYVQQLKIDIEKGKLSDNILKLEKQI
NKEKKLIRRGRTKGLIKEHETCFSEEGCLYQLNHHMEVLRELCEELPSQKSQQEVKRLLK
DYEQKIERLLKCASEIHMTLQPTAGGTSKNEGTITTSENRGGDPHSEAPFAKSDNQPSTE
KAMEPTKKFSLASELRPLQEESIMEKDYSASINSLLERYDTYRDILEHHLQNNKFRITSD
FSSEEDRSSSCLQAKLTDLQVIKNETDACWKEFEIISLKLENHVNDIKKPFVIKERDTLK
ERERELQMTLNTRMESLETALRLVLPVEKASLLLCGSDLPLHKMAIQGFHLIDADRIYQH
LRNIQDSIAKQIEICNRLEEPGNFVLKELHPFDLHAMQNIILKYKTQFEGMNHRVQRSED
TLKALEDFLASLRTAELSAEPVTDLSASDTQVAQENTLTVKNKEGEIHLMKDKAKHLDKC
LKMLDMSFKDAERGDDTSCENLLDAFSIKLSETHGCGVQEEFTEENKLLEACIFKNNELL
KNIQDVQSQISKIGLKDPTVPAVKHRKKSLIRLDKVLDEYEEEKRHLQEMANSLPHFKDG
REKTVNQQCQNTVVLWENTKALVTECLEQCGRVLELLKQYQNFKSILTTLIQKEESVISL
QASYMGKENLKKRIAEIEIVKEEFNEHLEVVDKINQICKNLQFYLNKMKTFEEPPFEKEA
NIIVDRWLDINEKTEDYYENLGRALALWDKLFNLKNVIDEWTEKALQKMELHQLTEEDRE
RLKEELQVHEQKTSEFSRRVAEIQFLLQSSEIPLELQVMESSILNKMEHVQKCLTGESNC
HALSGSTAELREDLDQAKTQIGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMILL
ENQIGCLTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLNDQCKNFNDWFSNIKMNLKE
CFESSETKKSVEQKLQKLSDFLTLEGRNSKIKQVDSVLKHVKKHLPKAHVKELISWLVGQ
EFELEKMESICQARAKELEDSLQQLLRLQDDHRNLSKWLTNQEEKWKGMEESGEKTELFC
QALARKREQFESVAQLNNSLKEYGFTEEEEIIMESTCLMDRYQTLLRQLSEIEEEDKLSP
TEDQSFNDLAHDVIHWIKEIKESLMVLNSSEGKMPLEERIQKIKEIILLKPEGDARIETI
MKQAESSEAPLVQKTLTDISNQWDNTLHLASTYLSHQEKLLLEGEKYLQSKEDLRLMLIE
LKKKQEAGFALQHGLQEKKAQLKIYKKFLKKAQDLTSLLKELKSQGNYLLECTKNPSFSE
EPWLEIKHLHESLLQQLQDSVQNLEGHVREHDSYQVCVTDLNTTLDNFSKEFVSFSDKPV
DQIVVEEKLQKLQELENRLSLQDGTLKKILALAKSVKQNTSSVGQKIIKDDIKSLQCKQK
DLENRLESAKQEMECCLNSILKSKRSTEKKEKFTLPGREKQATSDVQESTQESAAVEKLE
EDWEINKDSAVEMVMSKQLSLNAQESMKNTEDERKVNELQNQPLELDTMLRNEQLEEIEK
LYTQLQAKKAAIKPLEQTECLNKTETGALVLHNIGYSAQHLDNLLQALITLKKNKESQYC
VLRDFQEYLAAVESSMKALLTDKESLKVGPLDSVTYLDKIKKFIASIEKEKDSLGNLKIK
WENLSNHVTDMDKKLLESQIKQLEHGWEQVEQQIQKKYSQQVVEYDEFTTLMNKVQDTEI
SLQQQQQHLQLRLKSPEERAGNQSMIALTTDLQATKHGFSVLKGQAELQMKRIWGEKEKK
NLEDGINNLKKQWETLEPLHLEAENQIKKCDIRNKMKETILWAKNLLGELNPSIPLLPDD
ILSQIRKCKVTHDGILARQQSVESLAEEVKDKVPSLTTYEGGDLNNTLEDLRNQYQMLVL
KSTQRSQQLEFKLEERSNFFAMIRKFQLMVQESETLIIPRVETAATEAELKHHHVTLEAS
QKELQEIDSGISTHLQELTNIYEELNVFERLFLEDQLKNLKIRTNRIQRFIQNTCNEVEH
KIKFCRQFHEKTSALQEEVDSIQRNELLLNQEVNKGVKEEIYNLKDRLTAIKCCILQVLK
LKKVFDYIGLNWDFSQLDQLQTQVFEKEKELEEKIKQLDTFEEEHGKYQALLSKMRAIDL
QIKKMTEVVLKAPDSSPESRRLNAQILSQRIEKAKCLCDEIIKKLNENKAFDDSFKEKEI
LQIKLNAEENDKLYKVLQNMVLELSPKELDEKNFQDKLETSLHVLNQIKSQLQQPLLINL
EIKHIQNEKDNCEAFQGQVWAEMCSIKAVTAIEKQREENSSEASDVETKLREFEDLQMQL
NTSIDLRTNVLNDAYENLTRYKEAVTRAVESITSLEAILIPYRVDVGNPEESLEMPLRKQ
EELESTVAHIQDLTEKLGMISSPEAKLQLQCTLQELVSKNSAMKEAFKAQETEAERYLEN
YKCYRKIEEDIYTNLSKMETVLGQSMSSLPLSYREALERLEQSKALVSNLISTKEELMKL
RQILRLLRLRCTENDGICLLKIVSALWEKWLSLLEAAKEWEMWCEELKQEWKFVSEEIER
EAIILDNLQEELPEISKTKEAATTEELSELLDCLCQYGENVEKQQLLLTLLLQRIRSIQN
VPESSGAVETVPAFQEITSMKERCNKLLQKVQKNKELVQTEIQERHSFTKEIIALKNFFQ
QTTTSFQNMAFQDHPEKSEQFEELQSILKKGKLTFENIMEKLRIKYSEMYTIVPAEIESQ
VEECRKALEDIDEKISNEVLKSSPSYAMRRKIEEINNGLHNVEKMLQQKSKNIEKAQEIQ
KKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDNLMIPFQQYQQVSQRAECRTSQL
NKATVKMEEYSDLLKSTEAWIENTSHLLANPADYDSLRTLSHHASTLQMALEDSEQKHNL
LHSIFMDLEDLSIIFETDELTQSIQELSNQVTALQQKIMESLPQIQRMADDMVAIESEVK
SMEKRVSKIKTILLSKEIFDFSPEEHLKHGEVILENIRPMKKTIAEIVSYQVELRLPQTG
MKPLPVFQRTNQLLQDIKLLENMTQEQNELLKVVIKQTNECDEEIENLKQILNNYSAQFS
LEHMSPDQADKLPQLQGEIERMEKQILSLNQRKEDLLVDLKATVLNLHQHLKQEQEGVER
DRLPAVTSEEGGVAERDASERKLNRRGSMSYLAAVEEEVEESSVKSENGDEKAEPSPQSW
SSLWKHDKDMEEDRASSSSGTIVQEAYGKISTSDNSMAQILTPDSLNTEQGPECSLRPNQ
TEEGTTPPIEADTLDSSDAQGGLEPRVEKTRPEPAEVLHACKTQVAELELWLQQANVAVE
PETLNSDMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLK
TVKCNLEKVQMMLQEKHSEDQHPTILKKSSEPEHQEALQPVNLSELESIVTERPQFSRQK
DFQQQQVLELKPMEQKDFIKFIEFNAKKMWPQYCQHDKDTTQESSASNQATSPENDVPDS
ILSPQGQNGDKWQYLHHELSSKIKLPLPQLVEPQVSTNMGILPSVSMYNFRYPTTEELKT
YTTQLEDLRQEASNLQTQENMTEEAYINLDKKLFELFLTLSQCLSSVEEMLEMPRLYRED
GSGQQVHYETLALELKKLYLALSDKKGDLLKAMTWPGKNTNLLLECFDNLQVCLEHTQAA
AVCRSKSLKAGLDYNRSYQHEIKRLYDQLIKSKTSLQQSLNEISGQSVAEQLQKADAYRV
ELENAESRVAKLRDEGERLHLPYALLQEVYKLEDVLDSMWGMLRARYTELSGPFVTESQQ
DALLQGMVELVKIGKEKLAHGHLKQTKSKVALQAQIENHKVFFQKLVADMLLIQAYSAKI
LPSLLQNRETFWAEQVTEVKMLEEKSRQCGMKLQSLLQKWEEFDENYASLEKDLEILIST
LPSVSLVEETEERLVERISFYQQIKRNIGGKHARLYQTLNEGKQLVASVSCPELEGQIAK
LEEQWLSLNKKIDHELHRLQALLKHLLSYNRDSDQLTKWLESSQHTLNYWKEQSLNVSQD
LDTIRSNIDNFFEFSKEVDEKSSLKTAVISIGNQLLHLKETDTATLRASLAQFEQKWTML
ITQLPDIQEKLHQLQMEKLPSRKAITEMISWMNNVEHQTSDEDSMHSPSSASQVKHLLQK
HKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWHRVHGMLNR
KIQHLEQLLESITESENKIQILNNWMEAQEERLKTLQKPESVISVQKLLLDCQDIENQLA
IKSRALDELKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQVNQLKTSMQSVLQEWK
IYDQLYDEVNMMTIRFWYCMEHSKPVVLSLETLRCQVENLQSLQDEAESSEGSWEKLQEV
IGKLKGLCPSVAEIIEEKCQNTHKRWTQVNQAIADQLQKAQSLLQLWKAYSNAHSEAAAR
LKQQEAKFQQLANISMSGNNLAEILPPALQDIKELQHDVQKTKEAFLQNSSVLDRLPQPA
ESSTHMLLPGPLHSLQRAAYLEKMLLVKANEFEFVLSQFKDFGVRLESLKGLIMHEEENL
DRLHQQEKENPDSFLNHVLALTAQSPDIEHLNEVSLKLPLSDVAVKTLQNMNRQWIRATA
TALERCSELQGIGLNEKFLYCCEKWIQLLEKIEEALKVDVANSLPELLEQQKTYEMLEAE
VSINQTIADSYVTQSLQLLDTTEIENRPEFITEFSKLTDRWQNAVQGVRQRKGDVDGLVR
QWQDFTTSVENLFRFLTDTSHLLSAVKGQERFSLYQTRSLIHELKNKEIHFQRRRTTYAL
TLEAGEKLLLTTDLKTKESVGRRISQLQDSWKDMEPQLAEMIKQFQSTVETWDQCEKKIK
ELKSRLQVLKAQSEDPLPELHEDLHNEKELIKELEQSLASWTQNLKELQTMKADLTRHVL
VEDVMVLKEQIEHLHRQWEDLCLRVAIRKQEIEDRLNTWVVFNEKNKELCAWLVQMENKV
LQTADINIEEMIEKLQKDCMEEINLFSENKLQLKQMGDQLIKASNKSRAAEIDDKLNKIN
DRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQ
KRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNI
CAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTSAKEELKRFE
AFQRQIHERLTQLELINKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQRRVTAVLRRL
RHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKI
DQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSCTPGLEDEKEA
SENETDMEDPREIQTDSWRKRGESEEPSSPQSLCHLVAPGHERSGCETPVSVDSIPLEWD
HTGDVGGSSSHEEDEEGPYYSALSDVEIPENPEAYLKMTTKTLKASSGKSISDGHSWHVP
DSPSCPEHHYKQMEGDRNVPPVPPASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGSPQQE
DGGLAGITEQQSGAFDRWEMIQAQELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEML
KMAKPPSDIQEIELRVKRLQEILKAFDTYKALVVSVNVSSKEFLQTESPESTELQSRLRQ
LSLLWEAAQGAVDSWRGGLRQSLMQCQDFHQLSQNLLLWLASAENRRQKAHVTDPKADPR
ALLECQRELMQLEKELVERQPQVDMLQEISNSLLIKGYGEDYIEAEEKVHVIEKKLKQLR
EQVSQDLMALQGTQNPAPPLPSFDEVDSGDQPPATSVPAPRAKFRAVRTTEGEEETESRV
PGSTRPQRSFLSRVIRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPMLRY
TNGPPPT
Download sequence
Identical sequences 9598.ENSPTRP00000010906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]