SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000018787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000018787
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.67e-43
Family Cofilin-like 0.000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000018787
Sequence length 142
Comment (Pan troglodytes)
Sequence
MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKME
LPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV
FEIRTTDDLTEAWLQEKLSFFR
Download sequence
Identical sequences A0A0D9QV52 A0A2I3M1E3 A0A2J8SDG8 A0A2K5KVN9 A0A2K5W3N6 A0A2K5ZA90 A0A2K6BZ32 A0A2K6MB87 A0A2K6RWN9 G1RWI0 G3QVM6 H2QGA4 H9G259 O60234
9598.ENSPTRP00000018787 9606.ENSP00000253054 NP_004868.1.87134 NP_004868.1.92137 XP_003812292.1.60992 XP_004060758.1.27298 XP_005589229.1.63531 XP_005589230.1.63531 XP_007994953.1.81039 XP_007994954.1.81039 XP_008962896.1.60992 XP_010379218.1.97406 XP_011763116.1.29376 XP_011763117.1.29376 XP_011828759.1.47321 XP_011933322.1.92194 XP_014979382.1.72884 XP_014979383.1.72884 XP_016791408.1.37143 XP_017742941.1.44346 XP_017742942.1.44346 XP_017742943.1.44346 XP_512648.2.37143 ENSPTRP00000018787 ENSPANP00000004726 ENSGGOP00000006803 ENSP00000472249 ENSP00000472249 ENSGGOP00000006803 gi|4758440|ref|NP_004868.1| ENSPTRP00000018787 ENSP00000253054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]