SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000024957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000024957
Domain Number 1 Region: 19-163,208-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-35
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000024957
Sequence length 331
Comment (Pan troglodytes)
Sequence
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLPLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDQPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPRGAPN
Download sequence
Identical sequences H2QLV4
ENSPTRP00000024957 ENSPTRP00000024957 XP_008963056.1.60992 XP_009436845.1.37143 9598.ENSPTRP00000024957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]