SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000031270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000031270
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-85
Family Calponin-homology domain, CH-domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 1523-1739
Classification Level Classification E-value
Superfamily Plakin repeat 4.97e-45
Family Plakin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 1744-1926
Classification Level Classification E-value
Superfamily Plakin repeat 1.74e-39
Family Plakin repeat 0.00068
Further Details:      
 
Domain Number 4 Region: 6544-6703
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 6370-6487
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 6764-6920
Classification Level Classification E-value
Superfamily Spectrin repeat 3.73e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 5885-6044
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 6126-6266
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 5342-5499
Classification Level Classification E-value
Superfamily Spectrin repeat 6.42e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 4573-4733
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 6916-7031
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 13 Region: 4906-5060
Classification Level Classification E-value
Superfamily Spectrin repeat 9.67e-21
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 14 Region: 4105-4263
Classification Level Classification E-value
Superfamily Spectrin repeat 3.44e-20
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 15 Region: 7251-7330
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.18e-19
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 16 Region: 6260-6377
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-18
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 17 Region: 5778-5915
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-16
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 18 Region: 1235-1363,1390-1418
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-16
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 19 Region: 5119-5279
Classification Level Classification E-value
Superfamily Spectrin repeat 4.83e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 20 Region: 7162-7242
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000128
Family Polcalcin 0.044
Further Details:      
 
Domain Number 21 Region: 5496-5611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000209
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 22 Region: 4794-4916
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000243
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 23 Region: 5677-5823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000478
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 24 Region: 705-802
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000518
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 25 Region: 6042-6155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000864
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 26 Region: 3875-3997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000208
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 27 Region: 4013-4117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000205
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 28 Region: 4322-4442
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000185
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 608-701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000314
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 30 Region: 782-882,1003-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000331
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 7041-7102
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000878
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000031270
Domain Number - Region: 3390-3499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 3642-3755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0051
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1020-1170
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00563
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000031270
Sequence length 7545
Comment (Pan troglodytes)
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILARNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFSRATNELIWLNEKEEE
EVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRA
AMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIH
KLEDLVQESMEEKEELLQYKSTIASLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQI
EITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQN
VLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLE
DSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLEN
CEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASS
SVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAV
IADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHK
EKADQLVERWQNVLVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQP
ENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQK
SPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKE
HVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKQQLSEALQTMQLFLAK
HGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTIDQ
TTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQIL
CQLKELNKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLT
LQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVR
PQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVR
EGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGL
IWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIVDN
NTASILKNIILPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQ
TSEQTKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLD
VLSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTVI
NSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYENQ
SRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCDVNETENEDNTNRDSPIFDYS
PRLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPTLSFSDKTMLSGQRIGEKFQDQFLG
IAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDES
EIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDSDSDDDF
YDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVPQ
GALVGSLSVKNKAQCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTNI
LEGDESDSLTDYDIVGGKESFTASLKFDVSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEE
SYGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENE
NINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVIEKSNLPEYTTEIAGKSKENLLN
HEMVLKDVLPPIIKDTESEKTFGPASISHNNNNISSTSELGTDLANTKVKLIQGSELPEL
TDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSDL
IKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQF
PFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDD
ITSDITSWEGNTHFEKESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITA
PPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSEWCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQ
ALSPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIK
RITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDF
NQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDL
CNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQ
SLKTAFSSLSNVSSERTKQIMLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIE
IVNVQDPEYVKKRLEFLKANNVLKDLGHTKMHLETTAFDVQFFISEYAQDLSPNQSKQLL
RLLNTTQKCFLDVQESVTTQVERLETQLHLEQDRDDQKIVAERQQEYKEKLQGICDLLTQ
TENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKL
SREDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTK
IENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQ
VGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMK
ELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGTDDING
LMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDDGKVDTSATHREVQHKL
DHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVD
PKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLGARGSLLPAKNDIQKTLDDIVGRY
EDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSTALQDIIS
KNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETL
AKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKK
HLEVLHSLLKEISSHGLPSDKALVFEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQ
VLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISL
CNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLG
LLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQN
KSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQ
KLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATR
KPQYEQLTAAGQGILSRPGEDPSLHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKS
TQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQA
LCEDLSALVKEEYLKAELSRQLEGILKSFKDIEQKAENHVQHLQSACASSHQFQQMSRDF
QAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHIYEKTIAEGENLLLKTQ
GSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLRPWIDKCQNNL
EEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKS
LIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSN
KYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQ
VDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFL
KKLEALIASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEG
TIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGK
QQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQ
DALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEK
IATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLT
TIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLRQAVSIGQSLKVLSSREDKD
MVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSV
QDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKA
RYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQA
QMRQKELKKEAKNNKALLDSLNEVSNALLELVPWRAREGLEKMVAEDNERYRLVSDTITQ
KVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEKDQTSAQLQVQKTFTMEI
MRHKDIIDELVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSL
VNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMN
KTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQIL
ESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSEG
TDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTIKDTQ
DFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVK
KSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGT
DLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIW
DSLEERIINRQHKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPVGGDPKAIEIELA
KHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRK
QQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEA
KEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAM
EFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKT
GTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLME
WLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLA
DDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLA
EDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQE
LSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDAL
RTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAW
AKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQT
FMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQI
ETKNPRVNLLLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDG
ILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQ
VAKCKCAKRFQVEQIGDNKYRVSFQSNFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLV
KNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRG
RRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSG
EDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCS
DVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences 9598.ENSPTRP00000031270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]