SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000048712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000048712
Domain Number 1 Region: 51-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.65e-72
Family Calponin-homology domain, CH-domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 2214-2330
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 277-397
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1374-1525
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 724-855
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 1695-1851
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-22
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 1587-1738
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1111-1214
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-17
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 913-1068
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-17
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 10 Region: 617-712
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 406-515
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000589
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 476-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000763
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 13 Region: 1211-1324
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000048712
Sequence length 2369
Comment (Pan troglodytes)
Sequence
MAQVPGEVDNMEGLPAPNNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGPDLVDFSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNME
APDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDQVLEVGKIIERYEELAAELLAWIH
RTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKPVKFQEKGNLEVLLFSIQSKLRACNRR
LFVPREGCGIWDIDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLN
ENQRLVSQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALRFSQLQGY
QPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESWARDKERLL
EAAGGGGAAGAAGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRFGEELVA
AGGAVGPGADTVHLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADLDGLLD
WLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLATLGGASGAGP
LVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQWLLSM
RVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRSCQDHLNS
RWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGALQWRLSGL
EAALQALEPRQAALLEEAALLAERFPAQAARLHQGGEELGAEWGALASAAQACGEAVAAA
GRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVDQREEDYA
RIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHIYQLFLRD
LRQALVVLRNQNQENQLRAQQWMQKLHDQLELQHFLRDCHELDGWIHEKMLMARDGTRED
SHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAEL
ESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGGDLATVNSQLKKLQSM
ESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRLLEPLQERRRLLLASK
ELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGLRREIQAHGPRLEEVL
ERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQVLDAAFQVEQYYFDVAEVEA
WLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDS
EQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPEL
GQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEA
WAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTTPPEPRPSASSMQR
TLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLSACEDAR
LHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRDVSSVEVLMNYHQGLKTELEARV
PELTTCQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSEKWDRHWEWLQQXREXHQXAQ
EALEAXAXQTAQEPRRQSREXSSSEEEXEQXXRRQEAHRKAAAAREERXSTRRRQTTIEK
IKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTR
VGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPVTPAAAEQVRPRPERQE
SADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHSLTLGRYEQMERRRER
RERRLERQESSEQEMPIRGDLVKGKATLADIVEQLQEKEAGPGLPAGPSLPQPRELPPGR
LPNGLELPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPP
THTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGSTHGGEPLL
SLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVASSVAEHAEIARW
GQTLPTTSSTDEGNPKRESGDRRASGRRK
Download sequence
Identical sequences 9598.ENSPTRP00000048712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]