SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000052509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000052509
Domain Number 1 Region: 1-123,157-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.61e-78
Family Calponin-homology domain, CH-domain 0.0000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000052509
Sequence length 974
Comment (Pan troglodytes)
Sequence
ERENVQKRTFTRWINLHLEKCNPPLEVKDLFVDIQDGKILMALLEVLSGRNLLHEYKSSS
HRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIKELTGNLS
RNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRKTRKYGVAV
QDFAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLEKAFSIAQDALHIPRLLEPED
IMVDTPDEQSIMTYVAQFLERFPELEAEDIFDSDKEVPIESTFVRIKETPSEQESKVFVL
TENGERTYTVNHETSHPPPSKVFVCDKPESMKEFRLDGVSSHALSDSSTEFMHQIIDQVL
QGGPGKTSDISEPSPESSILSSRKENGRSNSLPIKKTVHFEADTYKDPFCSKNLSLCFEG
SPRVAKESLRQDGHVLAVEVAEEKEQKQESSKIPESSSDKVPGDIFLVEGTNNNSQSSSC
NGALESTACHDEESHSLSPPGENTVMADSFQIKVNLMTVEALEEGDYFEAIPLKASKFNS
DVIDFASTSQAFNKVPSPHETKPDEDAEAFENHAEKLGKRSIKSAHKKKDSPEPQVKMDK
HEPHQDSGEEAEGCPSAPEETPVDKKPEVHEKAKRKSTRPHYEEEGEDDDLQGVGEELSS
SPPSSCVSLETLGSHSEEGLDFKPSPPLSKVSVIPHDLFYFPHYEVPLAAVLEAYVEDPE
DLKNEEMDLEEPEGYMPDLDSREEEADGSQSSSSSSMPGESLPSASDQVLYLSRGGVGTT
PASEPAPLAPHEDHQQRETKENDPMDSHQSQECPNLENIANPLEENVTKESISSKKKEKR
KHVDHVESSLFVAPGSVQSSDDLEEDSSDYSIPSRTSHSDSSIYIRRHTNRSSESDHFSY
VQLRNAADLDDRRNRILTRKANSSGEAMSLGSHSPQSDSLTQLVQQPDMMYFILFLWLLV
YCLLLFPQLDVSRL
Download sequence
Identical sequences ENSPTRP00000052509 9598.ENSPTRP00000052509 ENSPTRP00000052509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]