SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000000084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000000084
Domain Number 1 Region: 9-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 268-390
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 504-625
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-32
Family Spectrin repeat 0.000000463
Further Details:      
 
Domain Number 4 Region: 385-500
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-24
Family Spectrin repeat 0.000000481
Further Details:      
 
Domain Number 5 Region: 732-860
Classification Level Classification E-value
Superfamily EF-hand 4.16e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Domain Number 6 Region: 632-739
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-21
Family Spectrin repeat 0.000000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000000084
Sequence length 887
Comment (Pongo pygmaeus)
Sequence
GVQYNYVYDEDEYMIQTEEWDRDLLLDPAWQKKQRKTFTAWCNSHLRKAGTQIENIEEDF
RNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGN
VKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGL
CALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIM
TYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLEN
RTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGK
MVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQ
KDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKI
CDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVH
SIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDE
LRTKWDKVKQLVPIRDQSLQEELARQHANERLRQFAAQANAIGPWIQNKMEEIARSSIQI
TGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELL
LTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGY
DLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILA
EELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences H2N3B7
9600.ENSPPYP00000000084 ENSPPYP00000000084 ENSPPYP00000000084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]