SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000001743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000001743
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 4649-4808
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 3223-3383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-28
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 3334-3491
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-26
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 5 Region: 4260-4372
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-25
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-24
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 7 Region: 5162-5238
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.22e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 2788-2945
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 9 Region: 4802-4919
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 10 Region: 4452-4590
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 4149-4263
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 3784-3927
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-21
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 13 Region: 3552-3708
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 1900-2029
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 15 Region: 4037-4154
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 16 Region: 1224-1353,1380-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 17 Region: 4337-4442
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-16
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 18 Region: 5073-5153
Classification Level Classification E-value
Superfamily EF-hand 7.05e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 19 Region: 3002-3162
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 20 Region: 2455-2579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000024
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 21 Region: 2678-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000558
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 22 Region: 1764-1887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000912
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 23 Region: 2363-2468
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000245
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 24 Region: 2226-2328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000301
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 25 Region: 682-784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000444
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 26 Region: 3708-3820
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000216
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 27 Region: 4928-4999,5027-5056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000369
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 28 Region: 2010-2144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000497
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 29 Region: 3931-4038
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000461
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 30 Region: 591-680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000694
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 31 Region: 1502-1659
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000824
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 32 Region: 2587-2688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000331
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 33 Region: 1424-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000216
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000001743
Domain Number - Region: 2159-2262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000864
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 789-863
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00971
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 3137-3215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000001743
Sequence length 5430
Comment (Pongo pygmaeus)
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEAWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLTKATHSSSASWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLMSW
NYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEE
EVEACKAHFQHLMKSMENEDKEETAAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTD
KDARQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEAVLADLSALEAHRSTL
RHWLSDVKDKNSVFSVLDEEIAKAKAVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVST
LARNTQGKATSSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EKEKKQISEQLHALNKAYHDLCDGSANQLQQLQSQLAHQTEQKTLQKQQNTCHQQLEDLC
SWVGQAERALAGHQGRTTRQDLSALQKNQSDLKDLQDDIQNHATSFATVVKDIEGFMEEN
QTKLSPRELTALREKLHQAKEQYEALQEQTRVAQKELEEAVTSALQQETEKSKAAKELAE
NKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSEASLEKGALDTTDGYMGVNQAPEKLDK
QREMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTPEEQQMLQEKLGELKEQYSTSL
AQSEAELKQVQTLQDELQKFLQDHREFESWLERSEKELENMHKGDSSPEALPSLLKRQGS
FSEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEIGNLVKDKLKDATERYTALHSKC
TRLGSHLNMLLGQYHQFQNSADSLQAWMQTCEANVEKLLSDTVASDPGVLQEQLATTKQL
QEELAEHQVPVEKLQKVARDIMEIEGEPAPDHKHVQETTDSILSHFQSLSYSLAERSSLL
QKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSSGVIQEALATNMKLKQDIARQKS
SLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFKQLCLQQQEKESSLKKLLPQAEMFE
HLSGKLQQFMENKSRMLASGNQPDQDITRFFQQIQELNLEMEDQQENLDTLEHLVTELSS
CGFALDLSQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETE
GSIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQG
KTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHERQESLQAILNRM
EEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKV
KEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVTVARQRQLEESASHLACFQAAES
QLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTG
PGDVSLSTSQLQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVRAV
GQRLSGQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQTLCDELSVLIGEQYLKDE
LKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPI
SAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKN
HWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSELQVTLDPVQLESSL
LRSKAMLSEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAITEELQAKT
GSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQAL
EPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIG
QFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIQVLKLDIEASEAE
CRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEDFYRKLKGLND
ATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGK
DCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELI
ANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQL
ESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA
KIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSEKIDSLQARYSEIQ
DRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHRQHADHLA
LNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLE
QARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQFQQRQKELKKEVMEHRLV
LDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQ
AADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEI
FGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEE
TRALIAQLPPPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMV
EEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRLRMPP
LIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKL
DQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPS
IIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLN
KTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKE
FKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKL
EGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQA
TVETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFH
SEIEDFLLELTRMENQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRL
MLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWL
TLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDV
VLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSEL
EISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDTQKLDNFLGEV
RDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVM
NLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSV
SKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKK
VEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALS
ELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVD
RVTKTYKRKNIEPTHAPFIEKSRSGGRKSLNQPTPPPMPILSQSEAKNPRINQLSARWQQ
VWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQD
GKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTD
ADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMAL
DEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSA
SQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTVA
KTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGN
SRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences H2N7W2
ENSPPYP00000001743 9600.ENSPPYP00000001743 ENSPPYP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]