SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000003930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000003930
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.28e-35
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000003930
Domain Number - Region: 1630-1706
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 1877-1904
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0889
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000003930
Sequence length 2356
Comment (Pongo pygmaeus)
Sequence
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QVLQGLQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIKDLQQDVTDGVL
LAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAI
LGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPATPQALCQPH
QPAPHQQSKAQAEMQSRLPGPTARVSAAGSEAKTRGGSTTANNRRSQSFNNYDKSKPVTS
PPPPPSSHEKEPLASSASSHPGMSDNAPASLESGSSSTPTNCSTSSAIPQPGTATKPWRS
KSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNSQKSMLEKLKLFNSKGGSKAGEGP
GSRDTSCERLETLPSFEESEELEAASRMLTTVGPASSSPKIALKGIAQRTFSRALTNKKS
SLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDVKEEPKEDPSGAAVPEMPKKSSKIA
SFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSPSAPAPSKEGERSRSGKPSSGLPQ
QKPQLDSRHSSSSSSLASSEGKGPGGTTLNHSISSQTVSGSVGTTQTTGSNTVSVQLPQP
QQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSTGVSMEPSHFTKTGQPALEELTGEDPE
ARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNITTEMSGRGILSLTGRPTP
LSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTESGRYVYSAPLRRQLASRGSSVCH
VDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTDDITSGYMTDGGLGLYTRRLNRLP
DGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYANTPA
SSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDESD
KSTSGKKNPVISQTGSWRRGMTAQVGITMPRTKPSAPAGALKTPGTGKTDDAKVSEKGRL
SPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANANSFGFKKQSGSAAGLAMITASGV
TVTSRSATLGKIPKSSALVSRSAGRKSSMDGAQNQDDGYLALSSRTNLQYRSLPRPSKSN
SRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTALGSSLPGLVNQTDKEKGISSDNE
SVASCNSVKVNPAAQPVSSPAQTNLQPGAKYPDVASPTLRRLFGGKPTKQVPIATAENMK
NSVVISNPHATMTQQGNLDSPSGSGILSSGSSSPLYSKNVDLNQSPLASSPSSAHSAPSN
SLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDISLSSGGGPSHNSSTGLIASSKDDS
LTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQDSDPHLDRNTLPKKGLRYTPTSQ
LRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSPSGTRFNFSQLASPTTVTQMSLSN
PTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRTMSRSGSFRDGFEEVHGSSLSLVS
STSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQ
SLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNSTAQSADLRIRR
QHSSDSVSSINSATSHSSVGSNIESDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHS
DIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEM
KLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISA
SPRQSMGLSPHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPH
LFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSTSE
TPELLPCGYLVGENTTISVTVKKSSKELRQYLSNLADQCNSENNAVDMPLVIILDNLHHV
SSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRF
LRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVD
GSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAASPQQHEWPPL
LQLRPEDVGFDGYSMPREGSTSKQMPLSDAEGDPLMNMLMRLQEAANYSSPQSYDSDSNS
NSHHDDILDSSLESTL
Download sequence
Identical sequences H2NDW7
ENSPPYP00000003930 ENSPPYP00000003930 9600.ENSPPYP00000003930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]