SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000010220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000010220
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.75e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000010220
Sequence length 327
Comment (Pongo pygmaeus)
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASRSDKDL
ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDVLYAS
EEHEGHTEEPEAEEQAHEQQPPQQEEY
Download sequence
Identical sequences A0A096N3K2 A0A0D9RZ80 A0A1D5QJG0 A0A2J8XG07 A0A2K5P6V6 A0A2K6AAT2 A0A2K6CGQ1 G7PWM8 Q5R4I6
ENSPANP00000006919 ENSMMUP00000023240 NP_001126960.1.23681 NP_001181170.1.72884 XP_005586935.1.63531 XP_007972460.1.81039 XP_011769345.1.29376 XP_011829803.1.47321 XP_011930172.1.92194 XP_014977203.1.72884 ENSPPYP00000010220 ENSMMUP00000023240 9544.ENSMMUP00000023240 9600.ENSPPYP00000010220 ENSPPYP00000010220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]