SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000011831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000011831
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000011831
Sequence length 47
Comment (Pongo pygmaeus)
Sequence
MALPQGLLTFRDVSIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSL
Download sequence
Identical sequences 9600.ENSPPYP00000011831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]