SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000013036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000013036
Domain Number 1 Region: 207-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.11e-25
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.11e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000013036
Sequence length 681
Comment (Pongo pygmaeus)
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRMELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRSAPPAPNAPDA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGCCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTP
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPNPRSRRYSGDSDSSAS
SAQSGPLGARSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGHHSWVPRGRGSGGSGRSTPQTPRARSP
AAPRLSRVSSPSPEFGTTPASIFRTPLQLDPQQEQQLFQRLEEEFLANARALEAIGSVTP
TGPAPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQLGDSGRTANGLPGPRSQALSS
SSDEGSPCPGMGGPVDAPGSPLAGPEPSRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPA
ELGTWHALHSVTPRAEPDSWM
Download sequence
Identical sequences H2P3Z0
ENSPPYP00000013036 9600.ENSPPYP00000013036 ENSPPYP00000013036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]