SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000014700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000014700
Domain Number 1 Region: 221-311
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-23
Family Thyroglobulin type-1 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 40-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.63e-18
Family Growth factor receptor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000014700
Sequence length 326
Comment (Pongo pygmaeus)
Sequence
MLPRVGCPALPLPPPPLLPLLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVA
PPAAVAAVAGGARMPCADLVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL
PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRK
PLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIS
TMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPT
IRGDPECHLFYNEQQEARGVHTQRMQ
Download sequence
Identical sequences H2P8J2
ENSPPYP00000014700 XP_003780748.1.23681 ENSPPYP00000014700 9600.ENSPPYP00000014700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]