SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000016999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9600.ENSPPYP00000016999
Domain Number - Region: 55-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0978
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000016999
Sequence length 304
Comment (Pongo pygmaeus)
Sequence
MAAAGREKRYLTQTAAALAKSPSLSPQLATPIRGRPKKCLVYPHAPKSSHLSRSVLRWLQ
GLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLAR
KKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVS
RSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQASGRRYNSKVKRGRAVPVLPNIGNGGSSHREIHVKQAGHSYYSVMKPIRNM
DKKP
Download sequence
Identical sequences H2PET0
9600.ENSPPYP00000016999 XP_002815357.1.23681 ENSPPYP00000016999 ENSPPYP00000016999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]