SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000017403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000017403
Domain Number 1 Region: 922-1049,1081-1286
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-80
Family p120GAP domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 72-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1516-1614
Classification Level Classification E-value
Superfamily RGC domain-like 4.18e-34
Family RGC domain 0.00000979
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000017403
Domain Number - Region: 728-786
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000664
Family Motor proteins 0.032
Further Details:      
 
Domain Number - Region: 633-665
Classification Level Classification E-value
Superfamily WW domain 0.00283
Family WW domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000017403
Sequence length 1614
Comment (Pongo pygmaeus)
Sequence
GKSARGGIQARRRGAEPASLASEGSRGGRAPGGPPETRRMPHEELPSLQRPRYGSIVDDE
RLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKF
FAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRKN
IPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGG
ILANELSVDEAALHAAVIAINEAVEKGIAEQTVVTLRNPNAVLTLVDDNLAPEYQKELWD
AKKKKEENARLKNSCISEEERDAYEELLTQAEIQGNINKVNRQAAVDHINAVIPEGDPEN
TLLALKKPEAQLPAVYPFAAAMYQNELFNLQKQNAMNYLAHEELLIAVEMLSAVALLNQA
LESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVKLEVLSQGQDNLSWNEIQNCID
MINAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAHAQHYQDVLYHA
KSQKLGDSESVSKVLWLDEIQQAVDEANVDEDRAKQWVTLVVDVNQCLEGKKSSDILSVL
KSSASNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHEKYDYYYNTDSKESS
WVTPESCLYKESWLTGKEIEDIIEEVTVGYIRENIWSASEELLLRFQATSSGPILREEFE
ARKSFLHEQEENVVKIQAFWKGYKQRKEYMHRQQTFIDNTDSIVKIQSWFRMATARKSYL
SRLQYFRDHNNEIVKIQSLLRANKARDDYKTLVGSENPPLTVIRKFVYLLDQSDLDFQEE
LEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRITLEDVISHSKKLNKKKGGEME
ILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNKSTKFMDTVIFT
LYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNTL
RQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVK
NKLEASIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVG
NLLYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHL
SSMNNYLSETYQEFRKYFKEACNVPEPEEKFNMDKYTDLVTVSKPVIYISIEEIISTHSL
LLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVDPNDPNKANTLSQLSKTEISLV
LTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLTEILETPATAQQEVDHATDMVS
RAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRTLEQTGHVSSENKYQDILNEIA
KDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQINYYDTYIKTCLDNLKRKNTRRS
IKLDGKGEPKGAKRAKPVKYTAAKLHEKGVLLDIDDLQTNQFKNVTFDIIATEDVGIFDV
RSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences 9600.ENSPPYP00000017403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]