SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018723
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-85
Family Calponin-homology domain, CH-domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 4420-4579
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 4249-4363
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 4641-4796
Classification Level Classification E-value
Superfamily Spectrin repeat 5.69e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 3763-3922
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-24
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 4004-4144
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 3222-3376
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-24
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 9 Region: 4791-4907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 10 Region: 2786-2940
Classification Level Classification E-value
Superfamily Spectrin repeat 5.21e-21
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1985-2143
Classification Level Classification E-value
Superfamily Spectrin repeat 1.6e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 5154-5236
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.09e-20
Family GAS2 domain 0.00054
Further Details:      
 
Domain Number 13 Region: 2453-2579
Classification Level Classification E-value
Superfamily Spectrin repeat 7.58e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 14 Region: 4857-4984,5014-5045
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 15 Region: 3656-3803
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 1204-1332,1359-1387
Classification Level Classification E-value
Superfamily Spectrin repeat 4e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 17 Region: 5065-5150
Classification Level Classification E-value
Superfamily EF-hand 5.13e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 18 Region: 2999-3159
Classification Level Classification E-value
Superfamily Spectrin repeat 6.14e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 19 Region: 3375-3489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000236
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 20 Region: 4137-4253
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000547
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 21 Region: 3438-3589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000202
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 22 Region: 2674-2796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000417
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 23 Region: 3920-4033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 24 Region: 1767-1876
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000008
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 25 Region: 673-776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000605
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 26 Region: 1893-1998
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000259
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 27 Region: 2586-2687
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000691
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 28 Region: 2202-2322
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000123
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2361-2470
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 608-699
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000445
Family Spectrin repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000018723
Domain Number - Region: 777-851,972-992
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000124
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 1523-1635
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 989-1139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00916
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018723
Sequence length 5461
Comment (Pongo pygmaeus)
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILARNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQAEQLVQRVAKLRDEIMALRNEC
SSVYSKGRMLTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPTGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEFFN
DAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIASLMGKAK
TIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEA
MVPSVCFTVPPPNKEAVDFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRAS
NVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELL
KSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKL
KKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLK
TVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHAL
EDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSL
KYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQ
KYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVT
LMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFS
KQKISSEEISTKKEQLSEALQTMQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSES
LKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVE
LKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSREDKALIEQKLNEAKIKCE
QLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGT
KHKQVIEQNGTHFREGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHE
KIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKAHYETALAESEKKMKLT
HSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDVNGLMTKLKRQKSFSEDVISHKG
DLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNN
LKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISS
QQFAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITLTR
SLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSAALQDIISKNIMLEQDIAGRQSSINAMN
EKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKL
QTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKDLEVLHTLLKEISSHGLPSD
KALVFEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIV
QPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSG
GAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQKA
QEESSAMMQWLQKMNKTATKWHQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDK
LTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLK
QWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGE
DPSLHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNK
LSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSR
QLEGILKSFKDIEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAK
LDVLESLIKDHKDFSKTLTAQSHIYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDT
FNKQVKERENKLKDSLEKALKYKEQVETLRPWIDKCQNNLEEIKVCLDPAEGENSIAKLK
SLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFSLE
NMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKCLTMLQTQQKSLQALKHQV
DLAKRLAQDLVVEASDSKGTSDVLLQAETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQN
TIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALIASNDNANKTCKMM
LATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQ
KAEEHEESQGPVGMETETINQQLNVFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTS
TQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQ
KPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIAATAEPTDKVKILKQLSLL
DSRWEALLNKAETRRQEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQ
IAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHS
RSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDI
LLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQL
ARRLHFTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRQKELKKEAKNNKALLDSLN
EVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAE
LSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDELVKSGHKIMTTCS
EEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSVI
SQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYV
AADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEK
IKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWE
NIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTIKDTQDFIRDLEDPGIDPSVVKQQQEA
AEAIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRID
KLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVQQEELKQFKSEAYQQQI
EMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQF
QHALDELLTWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGN
DLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWL
TDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAE
TNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVAS
RPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQ
SRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKA
QLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKS
VERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQK
ELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALR
QAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKA
TTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEA
LLAWLQWAETTLTEKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAA
DPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALER
RRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEF
IDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEV
TRQVAKCKCAKRFQVEQIGDNKYRVSFQSHFGDSQQLRLVRILRSTVMVRVGGGWMALDE
FLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQ
AAQAASPQVPATTTPKILHPLTRNYGKPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGS
KLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRG
SDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSK
R
Download sequence
Identical sequences 9600.ENSPPYP00000018723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]