SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000019115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000019115
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.82e-79
Family Calponin-homology domain, CH-domain 0.000000416
Further Details:      
 
Domain Number 2 Region: 2842-2966
Classification Level Classification E-value
Superfamily EF-hand 1.84e-49
Family EF-hand modules in multidomain proteins 0.00000581
Further Details:      
 
Domain Number 3 Region: 2968-3063
Classification Level Classification E-value
Superfamily EF-hand 2.47e-38
Family EF-hand modules in multidomain proteins 0.0000149
Further Details:      
 
Domain Number 4 Region: 1923-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 3.1e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 3043-3131
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2505-2636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 388-526
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000158
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 2281-2439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000406
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 963-1083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000677
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 12 Region: 2682-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000126
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 13 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000168
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 14 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000018
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 15 Region: 2055-2178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 16 Region: 1492-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000343
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 2804-2841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 1620-1745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000234
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 1083-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000216
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000019115
Domain Number - Region: 1414-1528
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000142
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1306-1396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00134
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 690-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number - Region: 2233-2299
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000019115
Sequence length 3433
Comment (Pongo pygmaeus)
Sequence
MAKYGEHETSPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTALEEEHESPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELLNWILKSKTAIQTTEIKEYMK
MQDTSEMKKKLKALEKEQRERIPRADELNQTGQILMEQMGKEGLPTEEIKNVLEKVLSEW
KNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSVSESSWQSLPSLKDS
CQWELTNLLGLHPKIEMARASCSALKSQPSAPDFVQRGFDSFLGRYQAVQQALEDRQQQL
ENELKGQPGHAYLETLKTLKDVLNDSENKAQVSLNVLNDLAKVEKALQEKKALDEMLENQ
KPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALKLRA
FEADSTVIEKWMDGVKDFLMKQQAAQGDDTGLQRQLDQCSAFVNEIETIESSLKNMKEIE
ANLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEIATQKSRLSESQEKAANLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKI
QAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLDVKDVDPDIIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMKKEAASLSEWL
SATETELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKADLNTITESSAALQNLIEGSEP
ILEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK
KPASKQEEIVKRLVSELDDANLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKV
SQHIKSAKLLIAQEPLYQCLVTTETFETGVPFSDLEKLENDIENMLKFVEKPLESSDEDE
KMDEERAQIEEVLQRGEEMLHQPMEDNKKEKIRLQLLLLHTRYNKIKAVPIQQRKMGKLA
SESRSSLLPTDYLVEINKILLCMDDVELSLNVPELNTAIYEDFSFQEDSLKNIKDQLDKL
GEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYSDRKGYFDRAMEEWRQ
FHCDLNDLTQWITEAEELLVDTCAPGGSLDLEKARIHQQELEEGISSHQPSFAALNRTGD
GIVQKLSQADGSFLKDKLAGLNQRWDAIVAEVKDRQPRLKGESKQVMEYRHQLDEIICWL
TKAEHAMQKRSTTELGENLQELRDLTKEMEVHAEKLKWLNRTELEMLSDKSLSLPERDKI
SESLRTVNMTWNKICREVPTTLKECIQEPSSVSQTRIAAHPSVQKVVLVSSASDIPVQSH
RTSEISVPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRH
PQLDYVFTLAQNLKNKASSSDVRTAITEKLERVKNQWDGTQHGVELRQQQLEDMIIDSLQ
WDDHREETEELMRKYEARLYILQQARRDPLTKQIADNQILLQELGPGDGIIMAFDNVLQK
LLEEYGSDDTRNVKETTEYLKTSWINLKQSIADRQNTLEAEWRTVQASRRDLENFLKWMQ
EAETTVNVLADASHRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKDE
ELKKQMPIGGDIPALQLQYDHCKALRRELKEKEYSILNAVDQARVFLADQPIEAPEEPRR
NLQSKTELTPEERAQKIAKAMRKQSSELKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINFKVKTVNDLSSQLS
PLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPS
QSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGLPVGSPPE
SIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDS
RINGVSPWASPQHSARSYSLDPDASGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTFP
SCCPNVPSRPQAM
Download sequence
Identical sequences H2PKI7
ENSPPYP00000019115 ENSPPYP00000019115 9600.ENSPPYP00000019115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]