SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000019163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000019163
Domain Number 1 Region: 12-103
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-24
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 7723-7878
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8102-8216
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7503-7627
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-19
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 3022-3144
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-17
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 4196-4353
Classification Level Classification E-value
Superfamily Spectrin repeat 1.52e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 7095-7226
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 8 Region: 6767-6898
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-16
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 9 Region: 2196-2326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000367
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 10 Region: 6642-6764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000713
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 11 Region: 3978-4134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000102
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 12 Region: 3450-3593
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000125
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 13 Region: 4751-4894
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000445
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 14 Region: 7631-7741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000648
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 6454-6572
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000107
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 1187-1332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000136
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 17 Region: 2414-2540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000187
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 18 Region: 2796-2907
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000497
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 19 Region: 350-492
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000072
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 7022-7129
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000114
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 21 Region: 3578-3692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 22 Region: 3256-3388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000202
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 23 Region: 5618-5756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 24 Region: 2568-2685
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000234
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 25 Region: 1984-2139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000423
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 26 Region: 7293-7436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000501
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 27 Region: 8179-8325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000054
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 28 Region: 5422-5497,5608-5654
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000733
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 29 Region: 4647-4769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000017
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 30 Region: 4864-4968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 1787-1926
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000672
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 880-1019
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000683
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 33 Region: 1660-1811
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000017
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 34 Region: 1338-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000273
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 5162-5281
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000276
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 36 Region: 3171-3282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000768
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 37 Region: 5286-5377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 38 Region: 3895-4023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000204
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 39 Region: 5766-5880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000317
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 40 Region: 2914-3014
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000374
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 41 Region: 6067-6172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000792
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 42 Region: 3689-3822
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000863
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 43 Region: 4565-4676
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000916
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 44 Region: 680-806
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000234
Family Spectrin repeat 0.0089
Further Details:      
 
Weak hits

Sequence:  9600.ENSPPYP00000019163
Domain Number - Region: 6322-6425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00103
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 4349-4463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00329
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 3797-3897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00417
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1493-1603
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0114
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number - Region: 1435-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 4969-5066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0352
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000019163
Sequence length 8465
Comment (Pongo pygmaeus)
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKREDKLIFKEMKVWIEQF
ERDLTRAQVVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQSWD
RVTSRLFDWHIQLDKSLPAPLGTIGAWLYRAEVALREEITIQQVHEETANTIQRKLEQHK
DLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKY
RLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMY
VKADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDRYGNTVASLQAWLE
DAEKMLNQSENAKKDFFRNLPHWIQQHTAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRW
RELFMEVKQYAQADEMDRMKKEYTDCVVTLSAFATEAHKKISEPLEVSFMNVKLLIQDLE
DIEQRVPVMDAQYKIITKTAHLITKESPQEEGKEMFATMSKLKEQLTKVKECYSPLLYES
QQLLIPLEELEKQMTSFYDSLGKIDEIITVLEREAQSSALFKQKHQELLACQENCKKTLT
LIEKGSQSVQKFVTLSNVLKHFDQTRLQRQIADVHVAFQSMVKKTGDWKKHVETNSRLMK
KFEESRAELEKVLRIAQEGLEEKGDPEELLRRHTEFFSQLDQRVLNAFLKACDELTDILP
EQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEECRTELDRETKLMP
QEGSEKIIKEHRVFFSDKGPHHLCEKRLQLIEELCVKLPVRDPVRDTPGTCHTTLKELKA
AIDSTYRKLMEDPDKWKDYTSRFSEFSSWISTNETQLKGIKGEAIDTASHGEVKRAVEEI
RNGVTKRGETLSWLKSRLKVLTEVSSENEAQKQGDELAKLSSSFKALVTLLSEVEKMLSN
FGDCVQYKEIVKNSLEELISGSKEVQEQAEKILDTENLFEAQQLLLHHQQKTKRISAKKR
DVQQQIAQAQQGEGGLPDRGREELRKLESTLDGLERSRERQERRIQVTLRKWERFETNKE
TVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTESIAVQAENLVKEASEIPLGP
QNKQLLQQQAKSIKEQVKKLEDTLEEDIKTMEMVKTKWDHFGSNFETLSVWITEKEKELN
ALETSSSAMDMQISQIKVTIQEIESKLSSIVGLEEEAQSFAQFVTTGESARIKAKLTQIR
RYWEELQEHAQCLEGTILGHLSQQQKFEENLRKIQQSVSEFEDKLAVPIKICSSATETYK
VLQEHMDLCQTLESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRVKERQTVL
ENLLAHWQRLEKELSSFLTWLERGEAIASSPEMGISADRVKVEGELQLIQINFLQSVVAE
HQQFDELLLSFSVWIKLFLSELQTTSEISVMDHQVALTRHKDHAAAVESKKGELQSLQGH
LAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVVERRQLALSHLAEFLQSHASLSGILHQ
LRQTVEATNSMNKNESDLIEKDLNDALQDAKALESAAVSLDGILSKAQYHLKIGSSEQRT
SCRAMADQLCGEVERIQNLLGTKQSEADALAVLKKAFQDQKEELLKSIEDIEERTDKERL
KEPTRQALQQRLRVFNQLEDELNSHEHELCWLKDKAKQIAQKDVAFAPEVDREINRLEVT
WDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSKVLENASSVIVTRTTIKDQEDLKWAFS
KHETAKNKMNYKQKDLDNFTSKGKHLLSELKKIHSSDFSLVKTDMESTVDKWLDVSEKLE
ENMDRLRVSLSIWDDVLSSRDEIEGWSNNSVPQMAENISNLDNRLRAEELLKEFESEVKN
KALRLEELHSKVNDLKELTKNLETPPDLQFIEADLRQKLEHAKEITEVAKGTLKDFTAQS
TQVEKFINDITTWLTKVEESLMNCAQTETCEGLKKVKDIQKELQSQQSNISSTQENLNSL
CRKYHSAELESLGRAMTGLIKKHEAMSQLCSKTQASLQESLEKHFSESMQEFQEWFLGAK
AAAKESSDRTGDSKVLEAKLHDLQNILDSVSDGQSKLDAVTQEGQTLYAHLSKQIVSSIQ
EQITKANEEFQAFLKQCLKDKQALQDCASELGSFEDQHRKLNLWIHEMEERFNTENLGES
KQHIPEKKNEVHKVEMFLEELLAARESLDKLSQRGQLLSEEGHGAGQEGRLCSQLLTSHQ
NLLRMTKEKLRSCQVALQEHEALEEALQSMWSWVKAIQDRLACAESTLGSKDTLEKRLSQ
IQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQRVIQTQLETLKEVWADIMSSSVHAQS
TLESVISQWNDYLERKNQLEQWMESVDQKVEHPLQPQPGLKEKFALLDHLQSILSEAEDH
TRALHRLIAKSRELYEKTEDESFKDTAQEELKTQFNDIMTVAKEKMRKVEEIVKDHLMYL
DAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKLSKIKELIDSREIGASRLSRVESLAPE
VKQNTTASGCELMHTEMQALRADWKQWEDSVFQTQSCLENLVSQMALSEQEFSGQVAQLE
QALEEFSALLKTWAQQLTLLEGKNTDEEIVECWHKGQEILDALQKAEPRTEDLKSQLNEL
CRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQNKEQILQQRFRKAFRDFQQWLVNAKIT
TAKCFDIPQNISEVSTSLQKIQEFLSESENGQHKLNMMLSKGELLSTLPTKEKAKGIQAK
VAAAKEDWKHFHSNLHQKESALESVLEEIHCYEPQLNRLKEKAQQLWEGQAASKSFRHRV
SQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAIHMLDSYCHPTSDKS
VLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQQQLQSVKDMWASLL
SAGIRCKSQLEGALSKWTSYQDDVRQFSGWMDSMEANLNESERQHAELRDKITMLGKAKL
LNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERAKEAVTKSEKLVRLH
QEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQVHCAEGQALLNSVLH
TREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTQFNNVVNKLRLMEQKFQQVDEWL
KTAEEKVSPRTRRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGARAQEILDESHVNSG
MGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESSLSPYSDWYGSTHKNFKNVATK
IDKVDTAMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEEGEAERLRKEIHDHM
EQLKELTSTARKEHMTPEKGLHLAKEFSDKCKALTQWIAEYQEILHVPEEPKMELYEKKA
QLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQSDYQDLCSIGKEHV
FSPEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETITQQLAHHKAMMEEIA
GFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAICSTAQRVYQSLEHE
LQKHVSRQDTLQQCQAWLSAVQPDLEPSPQPPLSRAEAVKQVKHFRALQEQARTYLDLLC
SMCDLSNASVKTTAKDIQQTEQTIEQRLVQAQNLTQGWEEIKHLKAELWIYLQDADQQLQ
NMKRRHSELELNIAQNMVSQVKDFMKKLQSKQASVNTIIEKVNKLTKKEESPEHKEINHL
NDQWLDLCRQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEWDNLARSDAESTAVH
LEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSHLEQRWFQLEDLIKR
KIQVSVTNLEELNVVQSRFQELMEWAEEQQPNIAEALKQSPPPDMAQNLLMDHLAICSEL
EAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDLVGQRRKYLNKALSE
KTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLW
AQGRELMKEVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKNLVSRKHFKEDFDKA
CHWLKQADIVTFPEINLMNESTELHTQLAKYQHILEQSPEYENLLLTLQRTGQTILPSLN
EVDHSYLSEKLNALPQQFNIIVALAKDKFYKVQEAILARKEYASLIELTTQSLSELEAQF
LRMSKVPTDLAVEEALSLQDGCRAILDEVAGLGEAVDELNQKKEGFRSTGQPWQPDKMLH
LVTLYHRMKRQTEQRVSLLEDTTSAYQEHEQMCQQLERQLKSVKEEQSKVNEETLPAEEK
LKMYHSLAGSLQDSGILLKRVTIHLEDLAPHLDPLAYEKARHQIQSWQEELKLLTSAIGE
TVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDIQEEIRKIQIHQEEV
QSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEALRTRQATLTEIYSQ
CQRYYQVFQAANDWLEDAQEMLQLAGNGLDVESAEENLKSHMEFFSTEDQFHSNLEELHS
LVATLDPLIKPTGKEDLEQKMASLELRSQRMSWDSAAQVDLLQRCTAQWHDYQKAREEVI
ELMNDTEKKLSEFSLLKTSSSHEAEEKLSEHKALVSVVNSFHEKIVALEEKASQLEKTGN
DASKATLSRSMTTVWQRWTRLRAVAQDQEKILEDAVDEWTGFNNKVKKATEMIDQLQDKL
PGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQQALSMLQDGAASTPGGEPPLM
QEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQETKEYLGNPTIEID
AQLEELQILLTEATNHRQNIEKMAEEQKDKYLGLYTILPSELSLQLAEVALDLKIRDQIQ
EKIKEVEQSKATSQELSRQIQKIAKDLTTILTKLKAKTDNLVQAKTDQKVLGEELDGCNS
KLMELDAAVQKFSEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLSKLNQAASHLEEYNE
MLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEIDSDLEAMTEKLQYLT
SVYCTEKMSQQVAELGRETEELRQMIKIRLQNLQDAAKDMKKFEAELKKLQAALEQAQAT
LTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPEDVVASLPLCHAALR
LQEEASRLQHTAIQQCNIMQAAVVQYEQYEQEMKHLQQLIEGAHREIEDKPVATSNIQEL
QAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDGE
LLPTPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPARRSPSPVANTDASVNQ
DIAYYQALSAERLQTDAAKIHPSTSTSQEFYEPGLEPSATAKLGDLQRSWETLKNVISEK
QRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQMAEHQALMDEILMLQ
DEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIRMKASGKRQLLEEKLND
QLEEQRQEQALQRYRCEAEELDSWLLSTKATLDTALSPPKEPMDMEAQLVDCQNMLVEIE
QKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLELQRALHDKQLNMQGTA
QEKEESDVDLTATQSPGVQEWLAQARTTWTQQRQSSLQQQKELEQELAEQKSLLRSVASR
GEEILIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRMKWESLHQEFSTKQKLLQ
NVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDGLNQAFEEVSSQSGGAKR
QSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQENLAKDIKEMSEEMD
KNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMKERLQQILNFQNDLK
VLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKELDAGIIELKRRGDKLQVEQ
PSMQELSKLQDMYDELMTLKSQYERLQDLADLETQKMAGDQKIIVSSKEEIQQLLDKHKE
YFQGLESHMILTETLFRKIISFAVQKETQFHTELMAQASAVLKRAHKRGVELEYILETWS
HLDEDQQELGRQLEVVESSIPSVGLVEENEDRLIDRITLYQHLKSSLNEYQPKLYQVLDD
GKRLLISISCSDLESQLNQLGERGISNTNKVSKELHRLETVLKHWTRYQSESADLIQWLQ
SAKDRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAQSSLKSSVLSTGNQLLRLKKV
DTATLRSELSHIDSQWTDLLTNIPAIQEKLHQLQMDKLPSRHAISEVMSWISLMENVIQK
DEDNIKNSIGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDF
AEQLGAMNKSWQILQGLVTEKIQLLEGLLESWSEYENNVQCLKTWFETQEKRLKQQHRIG
DQASVQNALKDCQDLEDLIKAKEKEVEKIEQNGLALIQNKKEDVSGIVMSTLRELGQTWA
NLDHMVGQLKILLKSVLDQWSNHKAAFDKINSYLMEARYSLSRFRLLTGSLEAVQVQVDN
LQNLQDDLEKHERSLQKFGSITNQLLKECHPPVTETLTNTLKEVNMRWNNLLEEIAEQLH
SSKALLQLWQRYKDYSKQCASTVQQQEDRTNELLKAATNKDIADDEVATWIQDCNDLLKG
LGTVKDSLFVLHELGEQLKQQVDASAASAIQSDQLSLSQHLCALEQALCKQQTSLQAGVL
DYETFAKSLEALEAWIVEAEEILQGQDPSHSSDLSTIQERMEELKGQMLKFSSMAPDLDR
LNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFL
VQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDE
FNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPVSGLGS
VPIPLQQARTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQAELTEIQD
KWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQM
RCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERIELLQRQWEELCHQLSLRR
QQIGERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLKKDYQEEIAIAQEN
KIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDK
NMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEV
LLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFE
DWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRT
DSACSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLT
NIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAIIEEELDEL
RRYCQEVFGRVERYHKKLIRLPLPDDEHDLSDRELELEDSAALSDLHWHDRSADSLLSPQ
PSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQD
DKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKG
YMKLLGECSGSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKE
LRMKQNLQKWQQFNSDLNSIWAWLGDTEEELEQLQRLELSTDIQTIELQIKKLKELQKAV
DHRKAIILSINLCSPEFTQADSKESRDLQDRLSQMNGRWDRVCSLLEEWRGLLQDALMQC
QDFHEMSHGLLLMLENIDRRKNEIVPIDSNLDAEILQDHHKQLMQIRHELLESQLRVASL
QDMSCQLLVNAEGTDCLEAKEKVHVIGNRLRLLLKEVSRHIKELEKLLDVSSSQQDLSSW
SSADELDTSGSVSPTSGRSTPNRQKTPRGKCSLSQPGPSVSSPHSRSTKGGSDSSLSEPG
PGRSGRAFLFRVLRTALPLQLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTN
GPPPL
Download sequence
Identical sequences H2PKN5
9600.ENSPPYP00000019163 ENSPPYP00000019163 ENSPPYP00000019163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]