SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000020178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000020178
Domain Number 1 Region: 5-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.89e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1311-1423
Classification Level Classification E-value
Superfamily E set domains 1.07e-35
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1501-1619
Classification Level Classification E-value
Superfamily E set domains 2.94e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 4 Region: 1425-1534
Classification Level Classification E-value
Superfamily E set domains 1.93e-33
Family Filamin repeat (rod domain) 0.0000217
Further Details:      
 
Domain Number 5 Region: 435-553
Classification Level Classification E-value
Superfamily E set domains 1.6e-31
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 6 Region: 1838-1933
Classification Level Classification E-value
Superfamily E set domains 6.14e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1126-1232
Classification Level Classification E-value
Superfamily E set domains 8.01e-31
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 
Domain Number 8 Region: 2023-2116
Classification Level Classification E-value
Superfamily E set domains 2.5e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 9 Region: 651-758
Classification Level Classification E-value
Superfamily E set domains 3.2e-30
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 10 Region: 1044-1135
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.00000971
Further Details:      
 
Domain Number 11 Region: 1222-1332
Classification Level Classification E-value
Superfamily E set domains 1e-29
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 12 Region: 735-847
Classification Level Classification E-value
Superfamily E set domains 7.34e-28
Family Filamin repeat (rod domain) 0.00089
Further Details:      
 
Domain Number 13 Region: 2296-2387
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 14 Region: 839-950
Classification Level Classification E-value
Superfamily E set domains 4.8e-27
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 15 Region: 2617-2707
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 16 Region: 1608-1722
Classification Level Classification E-value
Superfamily E set domains 1.07e-25
Family Filamin repeat (rod domain) 0.0000668
Further Details:      
 
Domain Number 17 Region: 257-353
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 18 Region: 357-456
Classification Level Classification E-value
Superfamily E set domains 2.74e-25
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 19 Region: 2487-2578
Classification Level Classification E-value
Superfamily E set domains 5.6e-25
Family Filamin repeat (rod domain) 0.00000419
Further Details:      
 
Domain Number 20 Region: 544-644
Classification Level Classification E-value
Superfamily E set domains 5.67e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 21 Region: 2394-2484
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 934-1038
Classification Level Classification E-value
Superfamily E set domains 1.53e-21
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 23 Region: 2229-2310
Classification Level Classification E-value
Superfamily E set domains 1e-19
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 24 Region: 1941-2037
Classification Level Classification E-value
Superfamily E set domains 5.4e-18
Family Filamin repeat (rod domain) 0.0000946
Further Details:      
 
Domain Number 25 Region: 1777-1855
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000020178
Sequence length 2708
Comment (Pongo pygmaeus)
Sequence
ETNEMPSAEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDLQRDLSDGLRLIALLEV
LSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWT
LILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVD
NCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQ
FPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIED
PEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDAN
KVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTF
RCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVAD
FKVFTKGAGSGELRVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAI
PRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKI
ECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPG
LEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPI
KHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQ
GDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASP
FHIKVDPSHDASRVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVR
DFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNS
KVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPY
KVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLG
LTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPS
KVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITY
SPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVD
ARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVP
KSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMS
CKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAG
VRARVPQTFTVDCSQAGRAPLQVAVLGPTGVPEPVEVRDNGDGTHTVHYTPATDGPYTVA
VKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTV
QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDA
SKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVE
NHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQLRQPYAP
PRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITD
NKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNK
PATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKH
IPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRL
PNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHT
FQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFAD
KHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTR
TFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGS
ITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQH
VPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSK
AEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSL
QETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVH
SIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSG
ALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGPQHIVGSPFKAKVTGPRL
SGGHSLHETSTVLVETVTKSSSSRGSGYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFT
VDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPG
SPFKVKVP
Download sequence
Identical sequences H2PNG5
ENSPPYP00000020178 9600.ENSPPYP00000020178 ENSPPYP00000020178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]