SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000022078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000022078
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000253
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.03e-27
Family Cold shock DNA-binding domain-like 0.00000552
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000549
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000022078
Sequence length 293
Comment (Pongo pygmaeus)
Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRDFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVK
RQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNC
IISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences H2PTP6
9600.ENSPPYP00000022078 XP_002820352.1.23681 ENSPPYP00000022078 ENSPPYP00000022078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]