SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000022162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000022162
Domain Number 1 Region: 1458-1597
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.26e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000218
Further Details:      
 
Domain Number 2 Region: 235-339
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000062
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000022162
Sequence length 1602
Comment (Pongo pygmaeus)
Sequence
MVDASGRAAPRGWRKMEASPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDL
RDPFYVDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIY
VMESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHLSARQSPYFPL
LEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKC
FYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTVLHQKSSRP
PVPISNATKRSFLGSPAAGTPADLQPPAQLLAEGCHRQYLHPEEPEYLGKGTAAFSPSHP
LLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHA
ASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTATKTHGKSLLSNVSIEDEEE
ELVAIVRADVAPQQADPEFPRASPRALGLIANARSPQGQLDTSESKPDSFFLEPLMPAVL
KPAKEKQVITKEDERGEGRPRSITSRRPSEGPQPLVRRKMTGSRDLNRTFTPIPCSEFPM
GIDPTETGPQAVETAGEVCGGPLALGGFDPFPQGPSTDGFFLHVGRADEDTEGRLYVSCS
KSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVLSRYIGEEESAKLQEDMKVK
EHEDKDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKT
TPDASESCPAPLTTWRQKREQSPSRHGRDPASLLASELVQLHMQLEEKRRAIEAQKKKME
ALSARQRLKLGKAAFLHVVKKGKAEASPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLMK
EEQREELLHEPQDVDKESLAFAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNEC
DLSIEKLNETISTLQQAILKISQQQEQLLMKSPTVPVPGSRNNSQDHKVKAPVHFVEPLS
PTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASS
HPWTPTDPGLDGALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILLEQMSLKEV
LDATVKEVGPSSSDVSGKESIPVEEPLRSRASLIEVDLSDLKAPDEDGELASLDGSADLV
SEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEAR
RKAEEDRVRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCS
DSGTKCSSTPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNASR
STDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSI
LEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSS
DRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK
Download sequence
Identical sequences 9600.ENSPPYP00000022162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]