SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000156825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000156825
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily DNA-binding domain 4.9e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000156825
Sequence length 291
Comment (Homo sapiens)
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV
Download sequence
Identical sequences H2R3B9 O95983
ENSPTRP00000045258 ENSPTRP00000045258 gi|4505119|ref|NP_003917.1| ENSP00000156825 NP_001268382.1.87134 NP_001268382.1.92137 XP_009432566.1.37143 ENSP00000156825 ENSP00000412302 HR6416 ENSP00000412302 9598.ENSPTRP00000045258 9606.ENSP00000156825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]