SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000206020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000206020
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily R3H domain 2.35e-23
Family R3H domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000206020
Sequence length 227
Comment (Homo sapiens)
Sequence
MADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFI
QDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDS
YRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAA
HMLQANKTYGCVPVANKRDTRSIEEAMNEIRAKKRLRQSGEELPPTS
Download sequence
Identical sequences A0A0D9RKE7 A0A2I3LJY8 A0A2K5IJ01 A0A2K5NXL9 A0A2K5Z4I3 A0A2K6AXV4 A0A2K6KPE6 A0A2K6Q3L1 G3R1B3 G7NI42 G7PTA1 H2NSD3 O75391
ENSGGOP00000008969 ENSPPYP00000008841 9600.ENSPPYP00000008841 9606.ENSP00000206020 ENSGGOP00000008969 ENSP00000206020 ENSPANP00000019564 NP_004881.2.87134 NP_004881.2.92137 XP_008008176.1.81039 XP_009249450.1.23681 XP_010366287.1.97406 XP_011724180.1.29376 XP_011813782.1.43180 XP_011850088.1.47321 XP_011910167.1.92194 XP_017721386.1.44346 XP_018868660.1.27298 ENSPPYP00000008841 ENSP00000206020 gi|118344454|ref|NP_004881.2| ENSP00000206020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]