SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000280191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9606.ENSP00000280191
Domain Number - Region: 55-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.1
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000280191
Sequence length 305
Comment (Homo sapiens)
Sequence
MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQ
GLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLAR
KKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVS
RSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
MDKKP
Download sequence
Identical sequences Q8NEY3
ENSP00000280191 9606.ENSP00000280191 NP_653245.2.87134 NP_653245.2.92137 ENSP00000280191 gi|31543825|ref|NP_653245.2| ENSP00000280191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]