SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000329266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000329266
Domain Number 1 Region: 63-139
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000962
Family Extracellular domain of cell surface receptors 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000329266
Sequence length 184
Comment (Homo sapiens)
Sequence
MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSR
VLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKT
VEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMG
ARRP
Download sequence
Identical sequences Q8IV16
ENSP00000329266 gi|30794264|ref|NP_835466.1| 9606.ENSP00000329266 ENSP00000329266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]