SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000355906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000355906
Domain Number 1 Region: 42-99
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-17
Family Kringle modules 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000355906
Sequence length 156
Comment (Homo sapiens)
Sequence
MSVPTSALDTQSPPTACTTKYIALCSLMPHGRHEHSVEIPKDQFASPTETGPSVQECYHS
NGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNEYVFVLYHKRRKGQLKFLLEES
CFKLTAQDSTCVRCRGRSKMSQEHCLGAKGLREEKC
Download sequence
Identical sequences 9606.ENSP00000355906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]