SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000372210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000372210
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000541
Family SNARE fusion complex 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000372210
Sequence length 111
Comment (Homo sapiens)
Sequence
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDF
TSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART
Download sequence
Identical sequences Q9NYM9
ENSP00000372210 ENSP00000372210 gi|149192862|ref|NP_001092257.1| 9606.ENSP00000372210 NP_001092257.1.87134 NP_001092257.1.92137 GO.55538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]