SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000384515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000384515
Domain Number 1 Region: 70-239,285-395
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-52
Family Calponin-homology domain, CH-domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000384515
Sequence length 397
Comment (Homo sapiens)
Sequence
MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSWGLCSQALMASLAGSLLPGSDRSG
VETSEYAQGGVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFK
ELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQ
KLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQV
VVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKH
LNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELML
DGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Download sequence
Identical sequences ENSP00000342492 ENSP00000384515 gi|51477696|ref|NP_001003828.1| 9606.ENSP00000384515 NP_001003828.1.87134 NP_001003828.1.92137 ENSP00000384515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]