SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000005694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000005694
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily vWA-like 2.92e-54
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 230-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000437
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 3 Region: 252-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000149
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 191-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000263
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  9615.ENSCAFP00000005694
Domain Number - Region: 369-395
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00196
Family Chicken cartilage matrix protein 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000005694
Sequence length 414
Comment (Canis familiaris)
Sequence
AGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSQIIDTLDIGAADTRVAVVNYASTVKI
EFHLQTYSDKQSLKQAVARITPLSTGTMSGLAIQTAMDEAFTEEAGARGPTSNIPKVAII
VTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLKIIASEPLDEHVFYVETYGVIEK
LSSRFQETFCASDPCALGTHQCQHVCVSDGDGKHHCECSQGYSLNADMKTCSAIDKCALN
THGCEHICVNDRTGSYHCECYEGYTLNEDKKTCSAQDQCAFGTHGCQHVCVNDRAGSHHC
ECYEGYTLNADNKTCSVRSKCAQGSHGCQHICVDDGVAAYHCDCYPGYILNEDDKTCSAI
EEARRLISTEDACGCEATLAFQDRVNSYLQRLNAKSLDDILGKLQADEYGQVRR
Download sequence
Identical sequences 9615.ENSCAFP00000005694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]