SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000013110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000013110
Domain Number 1 Region: 79-163
Classification Level Classification E-value
Superfamily PA domain 0.00000000785
Family PA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000013110
Sequence length 188
Comment (Canis familiaris)
Sequence
MVPGAAGWWCLVLWLPACVAAHGLRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRY
EQIHLVPAEPSEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVD
NDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFEL
LQPPWTFW
Download sequence
Identical sequences E2QRX3
XP_005686429.1.57651 XP_005969544.1.78601 XP_011978958.1.54773 XP_020739022.1.74333 XP_855166.2.84170 ENSCAFP00000013110 9615.ENSCAFP00000013110 ENSCAFP00000013110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]