SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000014207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000014207
Domain Number 1 Region: 344-570
Classification Level Classification E-value
Superfamily vWA-like 1.35e-60
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 8-217
Classification Level Classification E-value
Superfamily vWA-like 3.76e-55
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 220-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.026
Further Details:      
 
Domain Number 4 Region: 581-622
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000275
Family Chicken cartilage matrix protein 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000014207
Sequence length 626
Comment (Canis familiaris)
Sequence
MRGLLCWPLPVLLFLLQPWETLSQFAGPRCRTGPLDLVFVIDSSRSVRPFEFETMRQFLV
GLLRGLDVGPNATRVGVIQYSSQVQSVFPLGAFSRREDMERAIRALVPLAQGTMTGLAIQ
YAMNVAFSVAEGARPPEARVPRIAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADV
GSLRAMASPPLDEHVFLVESFNLIQEFGQQFRGRLCGKDLCAEGRHGCQHQCVSTPGTFR
CACNPGYQLAEDNKSCLAIDLCTGGTHGCEHHCISSPGSYFCRCRAGFVLQQDQRSCRAI
DHCGFGNHSCQHECVSTFGGPRCRCREGHDLLPDGRSCQARDLCNGVDHGCEFQCVSEGL
SYRCLCPEGQQLQADGKSCNRCREGHVDLVLLVDGSKSVRPQNFELVKRFVNQIVDFLDV
SPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFS
EAQGARPRALNVPRVGLVFTDGRSQDDISVWARRAKEEGIVMYAVGVGKAVEEELRQIAS
EPAELHVSYSPDFGTMTHLLENLRGSICPEEGIGAGTELRNLCECESLVEFQGRTLGALE
KLTQNHSLAQLTARLEDLENQLATQK
Download sequence
Identical sequences 9615.ENSCAFP00000014207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]