SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002001
Domain Number 1 Region: 586-811
Classification Level Classification E-value
Superfamily vWA-like 6.2e-63
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 2 Region: 21-212
Classification Level Classification E-value
Superfamily vWA-like 7.37e-55
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 215-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-18
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 4 Region: 298-417
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 545-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000624
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000002001
Domain Number - Region: 887-929
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000667
Family Chicken cartilage matrix protein 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002001
Sequence length 932
Comment (Felis catus)
Sequence
RPPSRSVSRGRHARTHPQTALLESSCENKRADLVFIIDSSRSVNTHDYAKVKEFIVDILQ
FLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN
IAFSEAEGARPLRENVLRVIMIVTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDLNTLK
AIGSEPHEDHVFLVANFSQMESLTSVFQNSSCMVHMCSILEHNCAHFCINTPGSYVCRCR
QGYILNSDQTTCRIQDLCAAEDHGCEQLCVNVLGSFVCQCYSGFMLAEDGKRCVAVDYCA
SENHGCEHECVNADGSYFCRCPKGFALNPDKKTCAKIDYCASPNHGCQHECVNTDHSYSC
RCLKGFILNPDKKTCRRINYCALNKPGCEHECINTEEGYSCRCRRGYSLDPNGKTCSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKDVCQAVDHGCEHICVNSDESYICKCREGFRLAEDGKRCRRKDICKSTYHGCEHICVNR
GNSYICKCSEGFVLAEDGRRCKRCTEGPVDLVFVIDGSKSLGEENFEIVKQFVTGIIDSL
AISPKAARVGLLQYSTQVRTEFTLRNFSSAKDMKKAVAHIKYMGKGSMTGLALKHMFERS
FTQVEGARPLSARVPRVAIVFTDGRAQDDVSEWASKAQANGITMYAVGVGKAIEEELQEI
ASEPTDKHLFYAEDFSTMGEISEKLKKGICEALEDSDGSQDSPAGELPKKAHQPTESEPV
TINIRDLLSCSNFAVQHRYLFEEDSVSRSTQKLFHSTKSSGSPLEEKHDQCKCENLIMFQ
NLANEEVRKLTQRXLLEETQRMEALENRLRYR
Download sequence
Identical sequences 9685.ENSFCAP00000002001 ENSFCAP00000002001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]