SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002164
Domain Number 1 Region: 64-135
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.35e-19
Family F1F0 ATP synthase subunit C 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002164
Sequence length 136
Comment (Felis catus)
Sequence
MQTTGALLIPSALIRCCTRDLIRPVSASFLSRSEIPSKQPSYRSSPLQVARREFQTSVVS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
Download sequence
Identical sequences M3VYC7
9685.ENSFCAP00000002164 ENSFCAP00000002164 XP_003996770.1.62641 XP_003996771.1.62641 XP_007085783.1.5354 XP_007085784.1.5354 XP_019271415.1.44245 XP_019271416.1.44245 ENSFCAP00000002164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]