SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002646
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.00000167
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000157
Family SOCS box-like 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002646
Sequence length 198
Comment (Felis catus)
Sequence
MTLRCLESSGNGAEGTQSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences M3WZ81
ENSFCAP00000019671 XP_011282456.1.62641 XP_019690894.1.62641 XP_019690895.1.62641 ENSFCAP00000002646 9685.ENSFCAP00000002646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]