SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000005063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000005063
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Globin-like 5.24e-33
Family Globins 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000005063
Sequence length 131
Comment (Felis catus)
Sequence
FFVNFPSAKQYFSQFKHMTEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKVSSVLAL
VGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKE
VGWVQQVPNAT
Download sequence
Identical sequences ENSFCAP00000005063 9685.ENSFCAP00000005063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]