SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000006353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000006353
Domain Number 1 Region: 16-105
Classification Level Classification E-value
Superfamily PapD-like 5.76e-19
Family MSP-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000006353
Sequence length 218
Comment (Felis catus)
Sequence
PARGSRGAPPPSGLVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGAALRFRVLCTAPAKY
TVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRA
PAYPLELQGQPDPTPHPGPPSWTAPPTARHFPENPHPQLATSSFLLFLLTGIVSVAFLLL
PLQDELGSQLPQILHVSLGQKLVAAYILGLLTMVFLRT
Download sequence
Identical sequences ENSFCAP00000006353 9685.ENSFCAP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]