SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000007379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9685.ENSFCAP00000007379
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0183
Family F1F0 ATP synthase subunit B, membrane domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000007379
Sequence length 55
Comment (Felis catus)
Sequence
TAAGSSAQQVVDQATEAGQKAMDQVAKATQETIDKTANQASETFSGFGKKFGLIR
Download sequence
Identical sequences ENSFCAP00000007379 9685.ENSFCAP00000007379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]