SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000013666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9685.ENSFCAP00000013666
Domain Number - Region: 62-155
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00496
Family Gonadodropin/Follitropin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000013666
Sequence length 205
Comment (Felis catus)
Sequence
MLCNGRPIGRELPARLGKILGHAALEATGMMLRVLVGAFLPAMLLAAPPPINKLALFPDK
SAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSM
WEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPGHGLSVYVQGEDAPGSQPGTRPHP
HPGGQTPEPEDPPGAPHAEEEGAED
Download sequence
Identical sequences ENSFCAP00000013666 9685.ENSFCAP00000013666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]