SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000000838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9796.ENSECAP00000000838
Domain Number - Region: 1-33
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000225
Family Snake venom toxins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000000838
Sequence length 34
Comment (Equus caballus)
Sequence
AQALDCHVCAYNGENCFNPMRCPAMVTYCMTTRT
Download sequence
Identical sequences F7DW45
9796.ENSECAP00000000838 ENSECAP00000000838 ENSECAP00000000838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]