SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000001166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000001166
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 4.67e-70
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000027
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.52e-22
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000001166
Sequence length 390
Comment (Equus caballus)
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPDEGSAVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHSRLCFMLRVGDLRKSMIISATIRMQVVRKTTSPEGEVVPLHQVEIPM
ENGVGGNSIFLVAPLIIYHAIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLDALT
LASARGPLRKRSVAVAKAKPKFSISPDSLS
Download sequence
Identical sequences F6TM38
9796.ENSECAP00000001166 ENSECAP00000001166 NP_001244000.1.31192 XP_014703355.1.49734 ENSECAP00000001166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]