SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000004015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000004015
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily eIF1-like 1.01e-38
Family eIF1-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000004015
Sequence length 103
Comment (Equus caballus)
Sequence
DPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN
GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Download sequence
Identical sequences A0A093I9Y9 D2HVF2 F7AXR6 M3W010
9796.ENSECAP00000004015 ENSECAP00000004015 ENSECAP00000004015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]