SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000011430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000011430
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 8.89e-48
Family TRADD, N-terminal domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 146-234
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000565
Family DEATH domain, DD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000011430
Sequence length 237
Comment (Equus caballus)
Sequence
MATGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALRTALAESSGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQACGRYLRAYREGALRAALQGCLEAALTLQSLLKLELRAA
AERLLLLTDKERCLMIRPLSLQDQQTFARSVGLKWRKVGRSLQRSCRALRDPVLDSLAYE
YEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLANPDGGLA
Download sequence
Identical sequences F7BI42
ENSECAP00000011430 9796.ENSECAP00000011430 ENSECAP00000011430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]