SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000017061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000017061
Domain Number 1 Region: 216-307
Classification Level Classification E-value
Superfamily PX domain 2.22e-25
Family PX domain 0.00068
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000017061
Domain Number - Region: 64-99
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0196
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0057
Further Details:      
 
Domain Number - Region: 28-58
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0863
Family Delta-sleep-inducing peptide immunoreactive peptide 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000017061
Sequence length 375
Comment (Equus caballus)
Sequence
VEASPPGPGSPLSSLLPPASVPESMTISELRQAIVAMMNRKDELEEENRSLRNLLDGEME
HSAALRQEVDTLKRKVAEQEERHVTKIQALARENEVLKVQLKKYVGAVQMLKREGQPAEV
PNLWNVDGEVTVTEQKPGEVAEELASSYERKLIEVAEMHGELIEFNERLHRALVAKEALV
SQMRQELIDLRGPVPGDLSQTSEDQSLSDFEISNRALINVWIPSVFLRGKATNAFHVYQV
YIRIKDDEWNVYRRYTEFRSLHHKLQNKYPQVRAYNFPPKKAIGNKDAKFVEERRKLLQN
YLRSVMNKVIQMVPEFAASPKKETLVQLVPFFIDITPPGEPLNKNSRPKVASRFPKLSRS
HPRETRNVEPQSGDL
Download sequence
Identical sequences F7DYQ1
ENSECAP00000017061 ENSECAP00000017061 9796.ENSECAP00000017061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]