SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000022140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000022140
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-39
Family SCAN domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.87e-19
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 315-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000022140
Sequence length 473
Comment (Equus caballus)
Sequence
MMTKVLGMATVLGPRPPQEQVGLVIVKVEEEEKGKCLPSLEMFRQRFRQFGYHDTPGPRE
ALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLLE
DLERELDEPGQQVSPPPNEQKQVWAKMSSSGTAKESLSGVQPQSVETIPKYESWGPLYIQ
ETGEEQDFTPELRQIQGSKSNTQNEASTDKPESSEESHAEGFQRDITPMITANKCEARLE
RQWVNLEKESGTKTPLLDKGSKKGRELIPTKPPPGERRYICAECGKAFSNSSNLTKHRRT
HTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEA
PYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKC
KECGKAFNHSSNFNKHHRIHTGEKPYWCNNCGKTFCSKSNLSKHQRVHTGEGE
Download sequence
Identical sequences F6RYN5
9796.ENSECAP00000022140 ENSECAP00000022140 ENSECAP00000022140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]