SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000005807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000005807
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 7.31e-25
Family Transforming growth factor (TGF)-beta 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000005807
Sequence length 76
Comment (Bos taurus)
Sequence
MGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRL
SPISILFIDSANNVVY
Download sequence
Identical sequences 9913.ENSBTAP00000005807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]