SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000015819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000015819
Domain Number 1 Region: 76-191
Classification Level Classification E-value
Superfamily POZ domain 1.33e-26
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000015819
Domain Number - Region: 708-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000588
Family Classic zinc finger, C2H2 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000015819
Sequence length 737
Comment (Bos taurus)
Sequence
KKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPGPALIHSTHSLTNSHAHPGS
SDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAA
GSPFFQDKLLLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKT
VIDECTRIVSQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIY
SALYACSMQNGSGERSFYSGAVVSHHETALGLPRDHHIEDPSWITRIHERSQQMERYLST
TPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDTDQAE
GTESEPKGESFDSGVSSSIGTEPDSVEQQFGPGAARDSQAEPAQPEQAAEAPAEGAPQPH
QLETGASSPERSNEVEVDNTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLT
SNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFVTVSQ
PGLSTFTAQLPAPQPLAPSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEK
PHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEKSYEC
YICKKKFSHKTLLERHVALHSASNGTPPAGTPPGSRAGPPGVGACTEGTTYVCSVCPAKF
DQIEQFNDHMRMHVSDG
Download sequence
Identical sequences F1MDT4
ENSBTAP00000015819 9913.ENSBTAP00000015819 ENSBTAP00000015819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]