SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000015929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000015929
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-26
Family SH2 domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000157
Family SOCS box-like 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000015929
Sequence length 198
Comment (Bos taurus)
Sequence
MTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTSTVWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences Q861R0
ENSBTAP00000015929 NP_803489.1.59421 NP_803489.1.76553 XP_005206158.1.76553 XP_005206159.1.76553 XP_010803126.1.76553 XP_015326402.1.76553 ENSBTAP00000015929 9913.ENSBTAP00000015929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]